Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii BlaNDM-1 (NDM-1), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Acinetobacter baumannii NDM-1 protein, partial

Gene Name

NDM-1

UniProt

F8UNN7

Expression Region

164-222aa

Organism

Acinetobacter baumannii

Target Sequence

AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22 kDa

References & Citations

MoMolecular characteristics and epidemiology of a novel sequence type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Molecular characteristics and Epidemiology of Novel Sequence Type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Complete sequence of the blaNDM-1-carrying plasmid pNDM-AB from Acinetobacter baumannii of food animal origin.Zhang W.J., Lu Z., Schwarz S., Zhang R.M., Wang X.M., Si W., Yu S., Chen L., Liu S.J. Antimicrob. Chemother. 68:1681-1682 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADA2a (TADA2A) (NM_001488) Human Over-expression Lysate
LY419898 100 µg

ADA2a (TADA2A) (NM_001488) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rat IL-21R Protein (His Tag)
PKSR030333 100 µg

Recombinant Rat IL-21R Protein (His Tag)

Sign In for Pricing
View Details
3,20-Dioxopregn-4-en-21-yl4-bromobenzenesulfonate
TRC-D263330-500MG 500 mg

3,20-Dioxopregn-4-en-21-yl4-bromobenzenesulfonate

Sign In for Pricing
View Details
Human SOX8 activation kit by CRISPRa
GA109382 1 Kit

Human SOX8 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Neural tissue
CS803828 5x 5 µm

Tissue FFPE Sections, Neural tissue

Sign In for Pricing
View Details
FBXO3 (C-term) Rabbit Polyclonal Antibody
AP51629PU-N 400 µL

FBXO3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details