Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Klebsiella pneumoniae OmpK36 (OmpK36)

Product Specifications

Product Name Alternative

(Outer membrane protein C) (Phosphoporin PhoE) (Porin OmpK36)

Abbreviation

Recombinant Klebsiella pneumoniae OmpK36 protein

Gene Name

OmpK36

UniProt

D6QLY3

Expression Region

22-372aa

Organism

Klebsiella pneumoniae

Target Sequence

AEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGTSPTNNGRGALKQNGDGFGTSLTYDIYDGISAGFAYSHSKRNGDQNRLDKGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRFSGNGESDSISGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDIEGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDENDFTRRAGISTDDVVALGLVYQF

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.8 kDa

References & Citations

"Built-in CTX-M extended-spectrum beta-lactamase gene in Klebsiella pneumoniae ensuring stable propagation of the multidrug-resistant pathogen in clinical settings." Yoon E.-J., Gwon B., Liu C., Kim D., Won D., Park S.G., Choi J.R., Jeong S.H.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHC sgRNA CRISPR Lentivector set (Human)
K2109501 3x 1.0 µg

SDHC sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CD41 (Integrin alpha IIb chain, gpIIb-IIIa, Platelet Membrane gpIIb-IIIa Complex) (MaxLight 405)
MBS6188214-01 0.1 mL

CD41 (Integrin alpha IIb chain, gpIIb-IIIa, Platelet Membrane gpIIb-IIIa Complex) (MaxLight 405)

Sign In for Pricing
View Details
CD41 (Integrin alpha IIb chain, gpIIb-IIIa, Platelet Membrane gpIIb-IIIa Complex) (MaxLight 405)
MBS6188214-02 5x 0.1 mL

CD41 (Integrin alpha IIb chain, gpIIb-IIIa, Platelet Membrane gpIIb-IIIa Complex) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Monoclonal DDX59 Antibody (OTI2G1) [Alexa Fluor 488]
NBP2-72229AF488 0.1 mL

Mouse Monoclonal DDX59 Antibody (OTI2G1) [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Thymidylate Synthase Rabbit mAb
E38MA4544 100 µL

Recombinant Thymidylate Synthase Rabbit mAb

Sign In for Pricing
View Details
Tenascin C Antibody
ASA-B1845 1 Each

Tenascin C Antibody

Sign In for Pricing
View Details