Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

Product Specifications

Product Name Alternative

5-HT-1D;5-HT1D; Serotonin 1D alpha receptor;5-HT-1D-alpha; Serotonin receptor 1D

Abbreviation

Recombinant Human HTR1D protein, partial

Gene Name

HTR1D

UniProt

P28221

Expression Region

1-38aa

Organism

Homo sapiens (Human)

Target Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

G-protein coupled receptor for 5-hydroxytryptamine (serotonin) . Also functions as a receptor for ergot alkaloid derivatives, various anxiolytic and antidepressant drugs and other psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Regulates the release of 5-hydroxytryptamine in the brain, and thereby affects neural activity. May also play a role in regulating the release of other neurotransmitters. May play a role in vasoconstriction.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.3 kDa

References & Citations

"Serotonin 5-HT1B and 5-HT1D receptors form homodimers when expressed alone and heterodimers when co-expressed." Xie Z., Lee S.P., O'Dowd B.F., George S.R. FEBS Lett. 456:63-67 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meis1 (NM_001193271) Mouse Tagged ORF Clone Lentiviral Particle
MR225806L2V 200 µL

Meis1 (NM_001193271) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ATG3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4013R-BF647 100 µL

ATG3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Compound T129332
orb3171515-01 1 mg

Compound T129332

Sign In for Pricing
View Details
Compound T129332
orb3171515-02 2 mg

Compound T129332

Sign In for Pricing
View Details
Compound T129332
orb3171515-03 3 mg

Compound T129332

Sign In for Pricing
View Details
Compound T129332
orb3171515-04 4 mg

Compound T129332

Sign In for Pricing
View Details