Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45G/DDIT2, Human (His)

GADD45G/DDIT2 protein is a key mediator that regulates growth and apoptosis through the MTK1/MEKK4 MAPKKK signaling pathway. Concentration-dependent homodimerization enhances its growth inhibitory activity and interaction with PCNA, suggesting a role in DNA repair. GADD45G/DDIT2 Protein, Human (His) is the recombinant human-derived GADD45G/DDIT2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GADD45G/DDIT2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gadd45g-ddit2-protein-human-his.html

Smiles

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Molecular Formula

10912 (Gene_ID) O95257 (M1-E159) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35G2 Rabbit Polyclonal Antibody
TA361845 100 µL

SLC35G2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P2Y6 Recombinant Rabbit Monoclonal Antibody [JG37-77]
ET7108-52 100 µL

P2Y6 Recombinant Rabbit Monoclonal Antibody [JG37-77]

Sign In for Pricing
View Details
Benzylaminopurine (6-BAP)
CN-B001-10G 10 g

Benzylaminopurine (6-BAP)

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), Biotin conjugate, 0.1mg/mL
BNCB1852-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (151), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM36 Antibody
KC-30292-01 50 μL

TRIM36 Antibody

Sign In for Pricing
View Details
TRIM36 Antibody
KC-30292-02 100 µL

TRIM36 Antibody

Sign In for Pricing
View Details