Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45G/DDIT2, Human (His)

GADD45G/DDIT2 protein is a key mediator that regulates growth and apoptosis through the MTK1/MEKK4 MAPKKK signaling pathway. Concentration-dependent homodimerization enhances its growth inhibitory activity and interaction with PCNA, suggesting a role in DNA repair. GADD45G/DDIT2 Protein, Human (His) is the recombinant human-derived GADD45G/DDIT2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GADD45G/DDIT2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gadd45g-ddit2-protein-human-his.html

Smiles

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Molecular Formula

10912 (Gene_ID) O95257 (M1-E159) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVGP1 (N-term) Rabbit Polyclonal Antibody
AP23959PU-N 50 µg

OVGP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SIT (SIT1) activation kit by CRISPRa
GA109076 1 Kit

Human SIT (SIT1) activation kit by CRISPRa

Sign In for Pricing
View Details
GCKR (NM_001486) Human Over-expression Lysate
LY400576 100 µg

GCKR (NM_001486) Human Over-expression Lysate

Sign In for Pricing
View Details
(1R,2S,5R,6R,9R,10S)-rel-1,2,5,6,9,10-Hexabromocyclododecane
TRC-H294105-5MG 5 mg

(1R,2S,5R,6R,9R,10S)-rel-1,2,5,6,9,10-Hexabromocyclododecane

Sign In for Pricing
View Details
Ginsenoside C-K
TRC-G410280-50MG 50 mg

Ginsenoside C-K

Sign In for Pricing
View Details
SNAIL (SNAI1) Rabbit Polyclonal Antibody
AP20370PU-N 100 µg

SNAIL (SNAI1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details