Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB2/HMG-2, Human (HEK293, His)

The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V (D) J reorganization. HMGB2/HMG-2 Protein, Human (HEK293, His) is the recombinant human-derived HMGB2/HMG-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB2/HMG-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb2-protein-human-hek-293-his.html

Purity

98.0

Smiles

GKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Molecular Formula

3148 (Gene_ID) P26583 (G2-E209) (Accession)

Molecular Weight

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His
AP7F274-01 1 mg

Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His

Sign In for Pricing
View Details
Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His
AP7F274-02 10 µg

Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His

Sign In for Pricing
View Details
Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His
AP7F274-03 200 µg

Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His

Sign In for Pricing
View Details
Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His
AP7F274-04 5 mg

Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His

Sign In for Pricing
View Details
Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His
AP7F274-05 50 µg

Recombinant Chicken Vascular Endothelial Growth Factor C (VEGFC), N-His

Sign In for Pricing
View Details
Mouse B3galnt2 (NM_178640) AAV Particle
MR208122A1V 250 µL

Mouse B3galnt2 (NM_178640) AAV Particle

Sign In for Pricing
View Details