Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Natural cytotoxicity triggering receptor 3 (NCR3), partial

Product Specifications

Product Name Alternative

Activating natural killer receptor p30; Natural killer cell p30-related protein

Abbreviation

Recombinant Human NCR3 protein, partial

Gene Name

NCR3

UniProt

O14931

Expression Region

1-135aa

Organism

Homo sapiens (Human)

Target Sequence

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation

Endotoxin

0

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Lyophilized

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS807750 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
AKR1C3 Human Gene Knockout Kit (CRISPR)
KN200210RB 1 Kit

AKR1C3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DMRT1 Mouse Monoclonal Antibody [Clone ID: OTI2H1]
CF807746 100 µg

DMRT1 Mouse Monoclonal Antibody [Clone ID: OTI2H1]

Sign In for Pricing
View Details
TRM11 (TRMT11) (NM_001031712) Human Over-expression Lysate
LY422163 100 µg

TRM11 (TRMT11) (NM_001031712) Human Over-expression Lysate

Sign In for Pricing
View Details
MOT13 Antibody
8C16688-AAT 50 µg

MOT13 Antibody

Sign In for Pricing
View Details
CDC23 (NM_004661) Human Over-expression Lysate
LC401477 20 µg

CDC23 (NM_004661) Human Over-expression Lysate

Sign In for Pricing
View Details