Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-6 receptor subunit alpha (IL6R), partial

Product Specifications

Product Name Alternative

IL-6R 1; Membrane glycoprotein 80

Abbreviation

Recombinant Human IL6R protein, partial

Gene Name

IL6R

UniProt

P08887

Expression Region

20-365aa

Organism

Homo sapiens (Human)

Target Sequence

LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Field of Research

Cancer

Relevance

Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-phase reactions and hematopoiesis. The interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling', the restricted expression of the IL6R limits classic IL6 signaling to only a few tissues such as the liver and some cells of the immune system. Whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Lyophilized

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX2 Rabbit Polyclonal Antibody (PE-Cy5)
orb956293 100 µL

DLX2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
3-Benzoyl-2-chloropyridine
sc-344867 100 mg

3-Benzoyl-2-chloropyridine

Sign In for Pricing
View Details
TMEM121 Protein Lysate (Mouse) with C-HA Tag
46877034 100 µg

TMEM121 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CD226 (pS329) Blocking Peptide
MBS8309189-01 1 mg

CD226 (pS329) Blocking Peptide

Sign In for Pricing
View Details
CD226 (pS329) Blocking Peptide
MBS8309189-02 5 mg

CD226 (pS329) Blocking Peptide

Sign In for Pricing
View Details
CD226 (pS329) Blocking Peptide
MBS8309189-03 5x 5 mg

CD226 (pS329) Blocking Peptide

Sign In for Pricing
View Details