Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue factor (F3), partial

Product Specifications

Product Name Alternative

Coagulation factor III; Thromboplastin

Abbreviation

Recombinant Human F3 protein, partial

Gene Name

F3

UniProt

P13726

Expression Region

33-251aa

Organism

Homo sapiens (Human)

Target Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade

Endotoxin

0

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Lyophilized

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

53.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-[2-[[ (1,1-Dimethylethoxy) carbonyl]methylamino]ethoxy]benzenepropanoic Acid Methyl Ester
429946 25 mg

4-[2-[[ (1,1-Dimethylethoxy) carbonyl]methylamino]ethoxy]benzenepropanoic Acid Methyl Ester

Sign In for Pricing
View Details
Genesig Real-Time PCR detection kit for Avian Influenza A Virus Subtype H7, Advanced
349095 1 Kit

Genesig Real-Time PCR detection kit for Avian Influenza A Virus Subtype H7, Advanced

Sign In for Pricing
View Details
Mmu-miR-409-5p miRNA Mimic
CMM0454-01 5 nmol

Mmu-miR-409-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-409-5p miRNA Mimic
CMM0454-02 10 nmol

Mmu-miR-409-5p miRNA Mimic

Sign In for Pricing
View Details
Human Growth Regulated Oncogene Gamma (GROg) ELISA Kit
orb1665999-01 48 Tests

Human Growth Regulated Oncogene Gamma (GROg) ELISA Kit

Sign In for Pricing
View Details
Human Growth Regulated Oncogene Gamma (GROg) ELISA Kit
orb1665999-02 96 Tests

Human Growth Regulated Oncogene Gamma (GROg) ELISA Kit

Sign In for Pricing
View Details