Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetranectin (CLEC3B)

Product Specifications

Product Name Alternative

(TN) (C-type lectin domain family 3 member B) (Plasminogen kringle 4-binding protein)

Abbreviation

Recombinant Human CLEC3B protein

Gene Name

CLEC3B

UniProt

P05452

Expression Region

22-202aa

Organism

Homo sapiens (Human)

Target Sequence

EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

Tag

N-terminal 6xHis-tagged

Source

E.coli

Field of Research

Cardiovascular

Relevance

Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Lyophilized

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.1 kDa

References & Citations

"Structure of the plasminogen kringle 4 binding calcium-free form of the C-type lectin-like domain of tetranectin." Nielbo S., Thomsen J.K., Graversen J.H., Jensen P.H., Etzerodt M., Poulsen F.M., Thogersen H.C. Biochemistry 43:8636-8643 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Deoxycholic Acid ELISA Kit
MBS7263642-01 48 Well

Bovine Deoxycholic Acid ELISA Kit

Sign In for Pricing
View Details
Bovine Deoxycholic Acid ELISA Kit
MBS7263642-02 96 Well

Bovine Deoxycholic Acid ELISA Kit

Sign In for Pricing
View Details
Bovine Deoxycholic Acid ELISA Kit
MBS7263642-03 5x 96 Well

Bovine Deoxycholic Acid ELISA Kit

Sign In for Pricing
View Details
Bovine Deoxycholic Acid ELISA Kit
MBS7263642-04 10x 96 Well

Bovine Deoxycholic Acid ELISA Kit

Sign In for Pricing
View Details
CKR-5 (Phospho Ser336) Polyclonal Antibody
MBS9459135-01 0.05 mL

CKR-5 (Phospho Ser336) Polyclonal Antibody

Sign In for Pricing
View Details
CKR-5 (Phospho Ser336) Polyclonal Antibody
MBS9459135-02 0.1 mL

CKR-5 (Phospho Ser336) Polyclonal Antibody

Sign In for Pricing
View Details