Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGL1, Human (HEK293, His)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, His) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FGL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgl1-protein-human-hek293-c-his.html

Purity

97.00

Smiles

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Molecular Formula

2267 (Gene_ID) Q08830 (L23-I312) (Accession)

Molecular Weight

Approximately 36.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASPM (NM_018136) Human Tagged Lenti ORF Clone
RC214770L1 10 µg

ASPM (NM_018136) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
KIAA1841 CRISPR All-in-one AAV vector set (with saCas9)(Human)
25642151 3x 1.0 µg DNA

KIAA1841 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
SAPK4 (MAPK13) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]
TA505850BM 100 µL

SAPK4 (MAPK13) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details
Lentiviral mouse Sardh shRNA (UAS) - Lentiviral mouseSardh shRNA (UAS, GFP) (25)
GTR15168428 1 Vial

Lentiviral mouse Sardh shRNA (UAS) - Lentiviral mouseSardh shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PCMV-EGFP-GLT8D1-3xFLAG-Neo Plasmid
PVT66244 2 µg

PCMV-EGFP-GLT8D1-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Sheep Olfactory receptor 6C3 (OR6C3) ELISA Kit
MBS7214070-01 48 Well

Sheep Olfactory receptor 6C3 (OR6C3) ELISA Kit

Sign In for Pricing
View Details