Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TL1A/TNFSF15, Human

TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human is the recombinant human-derived TL1A/TNFSF15 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TL1A/TNFSF15 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfsf15-protein-human.html

Purity

98.00

Smiles

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Formula

9966 (Gene_ID) O95150-1 (L72-L251) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey MT ELISA Kit
EMKM0037 96 Tests

Monkey MT ELISA Kit

Sign In for Pricing
View Details
Mouse atrial natriuretic factor,ANF ELISA KIT
JOT-EK0400Mo-01 96 Well

Mouse atrial natriuretic factor,ANF ELISA KIT

Sign In for Pricing
View Details
Mouse atrial natriuretic factor,ANF ELISA KIT
JOT-EK0400Mo-02 48 Well

Mouse atrial natriuretic factor,ANF ELISA KIT

Sign In for Pricing
View Details
PPIL4 siRNA (Human)
orb1854484-01 15 nmol

PPIL4 siRNA (Human)

Sign In for Pricing
View Details
PPIL4 siRNA (Human)
orb1854484-02 30 nmol

PPIL4 siRNA (Human)

Sign In for Pricing
View Details
MafB shRNA (m) Lentiviral Particles
sc-35840-V 200 µL

MafB shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details