Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIMS2 (Regulating Synaptic Membrane Exocytosis Protein 2, Rab3-interacting Molecule 2, RIM 2, Rab-3-interacting Protein 3, KIAA0751, RAB3IP3, RIM2)
132581 200 µL

RIMS2 (Regulating Synaptic Membrane Exocytosis Protein 2, Rab3-interacting Molecule 2, RIM 2, Rab-3-interacting Protein 3, KIAA0751, RAB3IP3, RIM2)

Sign In for Pricing
View Details
Human IgA1 Monoclonal Antibody, HRP
E55A11306 100 µL

Human IgA1 Monoclonal Antibody, HRP

Sign In for Pricing
View Details
BPHL, ID (BPHL, MCNAA, Valacyclovir hydrolase, Biphenyl hydrolase-like protein, Biphenyl hydrolase-related protein, Breast epithelial mucin-associated antigen) (FITC) discontinued
032562-FITC 200 µL

BPHL, ID (BPHL, MCNAA, Valacyclovir hydrolase, Biphenyl hydrolase-like protein, Biphenyl hydrolase-related protein, Breast epithelial mucin-associated antigen) (FITC) discontinued

Sign In for Pricing
View Details
Inter Alpha-Globulin Inhibitor H2 (ITIH2) Antibody
abx128880-01 100 µL

Inter Alpha-Globulin Inhibitor H2 (ITIH2) Antibody

Sign In for Pricing
View Details
Inter Alpha-Globulin Inhibitor H2 (ITIH2) Antibody
abx128880-02 200 µL

Inter Alpha-Globulin Inhibitor H2 (ITIH2) Antibody

Sign In for Pricing
View Details
Inter Alpha-Globulin Inhibitor H2 (ITIH2) Antibody
abx128880-03 1 mL

Inter Alpha-Globulin Inhibitor H2 (ITIH2) Antibody

Sign In for Pricing
View Details