Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ribonuclease P protein subunit p25-like protein (RPP25L) ELISA Kit
abx543271 96 Tests

Human Ribonuclease P protein subunit p25-like protein (RPP25L) ELISA Kit

Sign In for Pricing
View Details
OR10AA1P ORF Vector (Human) (pORF)
ORF026446 1.0 µg DNA

OR10AA1P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TKN1 Polyclonal Antibody
ABP60696-01 30 µL

TKN1 Polyclonal Antibody

Sign In for Pricing
View Details
TKN1 Polyclonal Antibody
ABP60696-02 100 µL

TKN1 Polyclonal Antibody

Sign In for Pricing
View Details
TKN1 Polyclonal Antibody
ABP60696-03 200 µL

TKN1 Polyclonal Antibody

Sign In for Pricing
View Details
PSAT1 Antibody / Phosphoserine aminotransferase
R32554 100 µg

PSAT1 Antibody / Phosphoserine aminotransferase

Sign In for Pricing
View Details