Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Msl3l2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3156404 1.0 µg DNA

Msl3l2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ATP6V1C2 siRNA (Human)
MBS8219280-01 15 nmol

ATP6V1C2 siRNA (Human)

Sign In for Pricing
View Details
ATP6V1C2 siRNA (Human)
MBS8219280-02 30 nmol

ATP6V1C2 siRNA (Human)

Sign In for Pricing
View Details
ATP6V1C2 siRNA (Human)
MBS8219280-03 5x 30 nmol

ATP6V1C2 siRNA (Human)

Sign In for Pricing
View Details
MICU3 Protein Vector (Rat) (pPM-C-HA)
PV265528 500 ng

MICU3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype V Glucose-6-phosphate isomerase (pgi)
MBS1158792-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype V Glucose-6-phosphate isomerase (pgi)

Sign In for Pricing
View Details