Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NLK activation kit by CRISPRa
GA109949 1 Kit

Human NLK activation kit by CRISPRa

Sign In for Pricing
View Details
Human IGSF21 activation kit by CRISPRa
GA113806 1 Kit

Human IGSF21 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal POMGNT1 Antibody
NBP1-82193-25ul 25 µL

Rabbit Polyclonal POMGNT1 Antibody

Sign In for Pricing
View Details
MIR1292 Human qPCR Primer Pair (MI0006433)
HP300120 200 Reactions

MIR1292 Human qPCR Primer Pair (MI0006433)

Sign In for Pricing
View Details
TWF2 Human siRNA Oligo Duplex (Locus ID 11344)
SR307778 1 Kit

TWF2 Human siRNA Oligo Duplex (Locus ID 11344)

Sign In for Pricing
View Details
Canine Anti-Neuronal Nuclear AutoAntibody 1 ELISA Kit
MBS735831-01 48 Well

Canine Anti-Neuronal Nuclear AutoAntibody 1 ELISA Kit

Sign In for Pricing
View Details