Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

JPT1 Rabbit Polyclonal Antibody
TA377150 100 µL

JPT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF596 Overexpression Lysate (Native) - (Dry Ice)
NBP2-09227 0.1 mg

ZNF596 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
IRAK3 (Interleukin-1 Receptor-Associated Kinase 3, ASRT5, FLJ13601, IRAK-M, IRAKM) (Biotin)
247692-Biotin 100 µL

IRAK3 (Interleukin-1 Receptor-Associated Kinase 3, ASRT5, FLJ13601, IRAK-M, IRAKM) (Biotin)

Sign In for Pricing
View Details
TMOD4 AAV Vector (Rat) (CMV)
47131106 1 µg

TMOD4 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Phospho-Tau (S199) Monoclonal Antibody, AbBy Fluor™ 680 Conjugated
bsm-63066R-BF680 100 µL

Phospho-Tau (S199) Monoclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Factor H (Complement Factor H, CFH, CFHL3, ARMD4, ARMS1, FH, H Factor 1, HF1, HF, HF2, HUS, MGC88246) (MaxLight 490)
MBS6377938-01 0.1 mL

Factor H (Complement Factor H, CFH, CFHL3, ARMD4, ARMS1, FH, H Factor 1, HF1, HF, HF2, HUS, MGC88246) (MaxLight 490)

Sign In for Pricing
View Details