Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-3xHA-GJA8-Neo Plasmid
PVT68741 2 µg

PCMV-3xHA-GJA8-Neo Plasmid

Sign In for Pricing
View Details
PACE4 (PCSK6) (NM_138324) Human Tagged ORF Clone
RG223928 10 µg

PACE4 (PCSK6) (NM_138324) Human Tagged ORF Clone

Sign In for Pricing
View Details
PPT1, ID (PPT1, PPT, Palmitoyl-protein thioesterase 1, Palmitoyl-protein hydrolase 1) (FITC)
MBS6336778-01 0.2 mL

PPT1, ID (PPT1, PPT, Palmitoyl-protein thioesterase 1, Palmitoyl-protein hydrolase 1) (FITC)

Sign In for Pricing
View Details
PPT1, ID (PPT1, PPT, Palmitoyl-protein thioesterase 1, Palmitoyl-protein hydrolase 1) (FITC)
MBS6336778-02 5x 0.2 mL

PPT1, ID (PPT1, PPT, Palmitoyl-protein thioesterase 1, Palmitoyl-protein hydrolase 1) (FITC)

Sign In for Pricing
View Details
Anti-Calpain 5 (CAPN5) Mouse Monoclonal Antibody [Clone ID: OTI7D2]
M08350 100 µL

Anti-Calpain 5 (CAPN5) Mouse Monoclonal Antibody [Clone ID: OTI7D2]

Sign In for Pricing
View Details
CNGA3 Antibody
MBS7043702-01 0.05 mL

CNGA3 Antibody

Sign In for Pricing
View Details