Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pBluescriptR-TMEM154 Plasmid
PVT21639 2 µg

pBluescriptR-TMEM154 Plasmid

Sign In for Pricing
View Details
Cortactin (EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate), Cttn, CORTACTIN, oncogene EMS1) (Control Peptide) discontinued
C7901-83B-P 100 µg

Cortactin (EMS1, ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate), Cttn, CORTACTIN, oncogene EMS1) (Control Peptide) discontinued

Sign In for Pricing
View Details
TRNAA18 CRISPRa sgRNA lentivector (set of three targets)(Human)
47886121 3x 1.0µg DNA

TRNAA18 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CAPN2 Knockout HCT116 Polyclonal Cells
ARG42191 1 Million

CAPN2 Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
Aciclovir (Acyclovir)
MBS384131-01 50 mg

Aciclovir (Acyclovir)

Sign In for Pricing
View Details
Aciclovir (Acyclovir)
MBS384131-02 1 mg

Aciclovir (Acyclovir)

Sign In for Pricing
View Details