Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNG1 (NM_002237) Human Tagged ORF Clone
RC207222 10 µg

KCNG1 (NM_002237) Human Tagged ORF Clone

Sign In for Pricing
View Details
TBC1D13 (1-400, His-tag) Human Protein
AR51122PU-N 500 µg

TBC1D13 (1-400, His-tag) Human Protein

Sign In for Pricing
View Details
Sephadex® G-50 Fine
sc-255033A 100 g

Sephadex® G-50 Fine

Sign In for Pricing
View Details
TRITC-conjugated Rabbit Anti-Rat IgG H&L
HY-P89211 1 Each

TRITC-conjugated Rabbit Anti-Rat IgG H&L

Sign In for Pricing
View Details
CELSR3
399128-01 50 µL

CELSR3

Sign In for Pricing
View Details
CELSR3
399128-02 100 µL

CELSR3

Sign In for Pricing
View Details