Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC125 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-6926R-BF555 100 µL

CCDC125 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Ttc8 (NM_001106752) Rat Tagged Lenti ORF Clone
RR211396L4 10 µg

Ttc8 (NM_001106752) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Bricd5 shRNA (UAS) - Lentiviral mouse Bricd5 shRNA (UAS, GFP) (100)
GTR15230133 1 Vial

Lentiviral mouse Bricd5 shRNA (UAS) - Lentiviral mouse Bricd5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
AIF1 antibody
FNab09944 100 µg

AIF1 antibody

Sign In for Pricing
View Details
ADAM32 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-5855R-PE-Cy5.5 100 µL

ADAM32 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
AKAP9 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV638926 1.0 µg DNA

AKAP9 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details