Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

QRSL1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV742206 1.0 µg DNA

QRSL1P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Rabbit Monoclonal CD8 alpha Antibody (YTS 105.18) [Alexa Fluor 647]
NBP2-52659AF647 0.1 mL

Rabbit Monoclonal CD8 alpha Antibody (YTS 105.18) [Alexa Fluor 647]

Sign In for Pricing
View Details
Arbutin monoester
441749 2 g

Arbutin monoester

Sign In for Pricing
View Details
FITC Anti-Mouse CD24 Antibody
RD21967F-01 25 µg

FITC Anti-Mouse CD24 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD24 Antibody
RD21967F-02 100 µg

FITC Anti-Mouse CD24 Antibody

Sign In for Pricing
View Details
Mgat1 (NM_001110150) Mouse Tagged ORF Clone
MG219048 10 µg

Mgat1 (NM_001110150) Mouse Tagged ORF Clone

Sign In for Pricing
View Details