Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPADS tetrasodium
MBS5755402 Inquire

PPADS tetrasodium

Sign In for Pricing
View Details
Cytochrome P450 19A1
522062-01 100 µL

Cytochrome P450 19A1

Sign In for Pricing
View Details
Cytochrome P450 19A1
522062-02 200 µL

Cytochrome P450 19A1

Sign In for Pricing
View Details
Sohlh1 (NM_001001714) Mouse Recombinant Protein
TP520153 20 µg

Sohlh1 (NM_001001714) Mouse Recombinant Protein

Sign In for Pricing
View Details
LGALS8 Peptide
MBS3236380-01 0.1 mg

LGALS8 Peptide

Sign In for Pricing
View Details
LGALS8 Peptide
MBS3236380-02 5x 0.1 mg

LGALS8 Peptide

Sign In for Pricing
View Details