Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NAIP Antibody
RC-16233-01 50 μL

Recombinant NAIP Antibody

Sign In for Pricing
View Details
Recombinant NAIP Antibody
RC-16233-02 100 µL

Recombinant NAIP Antibody

Sign In for Pricing
View Details
Recombinant NAIP Antibody
RC-16233-03 1 mL

Recombinant NAIP Antibody

Sign In for Pricing
View Details
VIPR1 Antibody
R30849 100 µg

VIPR1 Antibody

Sign In for Pricing
View Details
Wbp1 (NM_001083923) Mouse Tagged ORF Clone Lentiviral Particle
MR216828L4V 200 µL

Wbp1 (NM_001083923) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FOXM1 Rabbit pAb
E47R2687 100 µL

FOXM1 Rabbit pAb

Sign In for Pricing
View Details