Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrig3 sgRNA CRISPR Lentivector set (Mouse)
K3686101 3x 1.0 µg

Lrig3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
LARP5 Polyclonal Antibody
E-AB-90569-01 60 µL

LARP5 Polyclonal Antibody

Sign In for Pricing
View Details
LARP5 Polyclonal Antibody
E-AB-90569-02 120 µL

LARP5 Polyclonal Antibody

Sign In for Pricing
View Details
LARP5 Polyclonal Antibody
E-AB-90569-03 200 µL

LARP5 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human MRLN sgRNA gene knockout kit - Lentiviral human MRLN sgRNA gene knockout kit (plasmid)
GTR15356207 1 Vial

Lentiviral human MRLN sgRNA gene knockout kit - Lentiviral human MRLN sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PRKRIP1 (PRKR Interacting Protein 1 (IL11 Inducible), C114, FLJ13902, FLJ40957) (APC)
250501-APC 100 µL

PRKRIP1 (PRKR Interacting Protein 1 (IL11 Inducible), C114, FLJ13902, FLJ40957) (APC)

Sign In for Pricing
View Details