Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-19, Mouse (His)

The IL-19 protein functions as a multifaceted cytokine, acting as both an anti-inflammatory and a pro-angiogenic factor. It plays a key role in polarizing adaptive immunity toward an anti-inflammatory phenotype by inducing T helper 2 responses. Animal-Free IL-19 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-19 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-19-protein-mouse-his.html

Purity

95.0

Smiles

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA

Molecular Formula

329244 (Gene_ID) Q8CJ70 (L25-A176) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTTY15 ORF Vector (Human) (pORF)
ORF035278 1.0 µg DNA

TTTY15 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
10-Acetylphenothiazine
411594-01 1 g

10-Acetylphenothiazine

Sign In for Pricing
View Details
10-Acetylphenothiazine
411594-02 2.5 g

10-Acetylphenothiazine

Sign In for Pricing
View Details
Recombinant Mouse Cyclic AMP-responsive element-binding protein 1 (Creb1)
MBS953044-01 0.02 mg (E-Coli)

Recombinant Mouse Cyclic AMP-responsive element-binding protein 1 (Creb1)

Sign In for Pricing
View Details
Recombinant Mouse Cyclic AMP-responsive element-binding protein 1 (Creb1)
MBS953044-02 0.02 mg (Yeast)

Recombinant Mouse Cyclic AMP-responsive element-binding protein 1 (Creb1)

Sign In for Pricing
View Details
Recombinant Mouse Cyclic AMP-responsive element-binding protein 1 (Creb1)
MBS953044-03 0.1 mg (E-Coli)

Recombinant Mouse Cyclic AMP-responsive element-binding protein 1 (Creb1)

Sign In for Pricing
View Details