GABARAPL1/GEC-1, Human (His)
GABARAPL1/GEC-1 is a multifunctional ubiquitin-like modifier that contributes to cell surface expression of kappa-type opioid receptors and contributes to autophagy, shaping autophagosome vacuoles.Unlike LC3, which is involved in phagophore elongation, the GABARAP/GATE-16 subfamily plays a crucial role in late autophagosome maturation.GABARAPL1/GEC-1 Protein, Human (His) is the recombinant human-derived GABARAPL1/GEC-1 protein, expressed by E.coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
GABARAPL1/GEC-1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gabarapl1-protein-human-his.html
Purity
95.30
Smiles
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Molecular Formula
23710 (Gene_ID) Q9H0R8 (M1-K117) (Accession)
Molecular Weight
Approximately 20.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
EDNRB (Endothelin B Receptor, ETB, ET-B, ETBR, ETRB, HSCR, WS4A, ABCDS, ET-BR, HSCR2) (Biotin)
EDNRB (Endothelin B Receptor, ETB, ET-B, ETBR, ETRB, HSCR, WS4A, ABCDS, ET-BR, HSCR2) (Biotin)
Recombinant Varicella-zoster virus Envelope glycoprotein H (gH), partial
Recombinant Varicella-zoster virus Envelope glycoprotein H (gH), partial
Recombinant Varicella-zoster virus Envelope glycoprotein H (gH), partial