Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (ovine)

Product Specifications

Synonyms

Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His- Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2; H-YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

Molecular Formula

C214H348N60O65S

Molecular Weight

4,833.59 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit
RDR-MYH10-Hu-01 96 Tests

Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit
RDR-MYH10-Hu-02 48 Tests

Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit

Sign In for Pricing
View Details
Human E3 Ubiquitin-Protein Ligase SMURF1 (SMURF1) ELISA Kit
RD-SMURF1-Hu-01 96 Tests

Human E3 Ubiquitin-Protein Ligase SMURF1 (SMURF1) ELISA Kit

Sign In for Pricing
View Details
Human E3 Ubiquitin-Protein Ligase SMURF1 (SMURF1) ELISA Kit
RD-SMURF1-Hu-02 48 Tests

Human E3 Ubiquitin-Protein Ligase SMURF1 (SMURF1) ELISA Kit

Sign In for Pricing
View Details
CD95 (B-R18), CF568 conjugate, 0.1mg/mL
BNC680305-100 1x 100 µL

CD95 (B-R18), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AVEN activation kit by CRISPRa
GA111369 1 Kit

Human AVEN activation kit by CRISPRa

Sign In for Pricing
View Details