Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (ovine)

Product Specifications

Synonyms

Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His- Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2; H-YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

Molecular Formula

C214H348N60O65S

Molecular Weight

4,833.59 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human/Mouse VEGFC Recombinant Rabbit monoclonal Antibody
HA723241 100 µL

Human/Mouse VEGFC Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF594 conjugate, 0.1mg/mL
BNC942432-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ifna2 Mouse Gene Knockout Kit (CRISPR)
KN308131 1 Kit

Ifna2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tstd3 Mouse Gene Knockout Kit (CRISPR)
KN518388 1 Kit

Tstd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FMOC-Lys (TF3) -OH
5051-AAT 100 mg

FMOC-Lys (TF3) -OH

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB502443 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details