Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (ovine)

Product Specifications

Synonyms

Tyr-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His- Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2; H-YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

Molecular Formula

C214H348N60O65S

Molecular Weight

4,833.59 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF640R conjugate, 0.1mg/mL
BNC402273-100 1x 100 µL

Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD99 Antibody[HI156]
E-AB-F1339M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD99 Antibody[HI156]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD99 Antibody[HI156]
E-AB-F1339M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD99 Antibody[HI156]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD99 Antibody[HI156]
E-AB-F1339M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD99 Antibody[HI156]

Sign In for Pricing
View Details
(1S,3R)-3-Aminocyclohexanol Hydrochloride
TRC-A604455-250MG 250 mg

(1S,3R)-3-Aminocyclohexanol Hydrochloride

Sign In for Pricing
View Details
Human GTF3C3 activation kit by CRISPRa
GA106219 1 Kit

Human GTF3C3 activation kit by CRISPRa

Sign In for Pricing
View Details