What is the catalog number for [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat?

The catalog number for [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is VAC-00921.

What sizes are available for [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat?

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat come in?

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is available in 3 different pack sizes.

Is [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat in stock?

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is currently made to order / not held in immediate stock. Contact us for lead time.

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat

Product Specifications

Synonyms

Tyr-Ser-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val- Gly-Ser-Glu-Ala-Phe-NH2; H-YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2

Molecular Formula

C171H271N51O54S2

Molecular Weight

3,969.50 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS2090896-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing

View Details

MBS2090896-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing

View Details

MBS2090896-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing

View Details

MBS2090896-04 1 mL

Biotin-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing

View Details

MBS2090896-05 5 mL

Biotin-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing

View Details

MBS2090896-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Tissue Inhibitors Of Metalloproteinase 1 (TIMP1)

Sign In for Pricing

View Details