Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat

Product Specifications

Synonyms

Tyr-Ser-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val- Gly-Ser-Glu-Ala-Phe-NH2; H-YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2

Molecular Formula

C171H271N51O54S2

Molecular Weight

3,969.50 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP11B Protein Vector (Human) (pPB-His-GST)
PV323251 500 ng

ARHGAP11B Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Sodium thiosulfate
S5561-01 250 g

Sodium thiosulfate

Sign In for Pricing
View Details
Sodium thiosulfate
S5561-02 500 g

Sodium thiosulfate

Sign In for Pricing
View Details
Sodium thiosulfate
S5561-03 1 Kg

Sodium thiosulfate

Sign In for Pricing
View Details
Chic1 (NM_009767) Mouse Tagged ORF Clone
MG220546 10 µg

Chic1 (NM_009767) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
H mg2L1 polyclonal antibody
6863-50 50 µL

H mg2L1 polyclonal antibody

Sign In for Pricing
View Details