What is the catalog number for [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat?

The catalog number for [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is VAC-00921.

What sizes are available for [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat?

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat come in?

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is available in 3 different pack sizes.

Is [Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat in stock?

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat is currently made to order / not held in immediate stock. Contact us for lead time.

[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat

Product Specifications

Synonyms

Tyr-Ser-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asp-Asn-Phe-Val-Pro-Thr-Asn-Val- Gly-Ser-Glu-Ala-Phe-NH2; H-YSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2

Molecular Formula

C171H271N51O54S2

Molecular Weight

3,969.50 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARP53357_P050-Biotin 100 µL

PTH2 Antibody - middle region : Biotin (ARP53357_P050-Biotin)

Sign In for Pricing

View Details

RHE89701 100 μg

Anti-Human LUM/Lumican Antibody (RB130)

Sign In for Pricing

View Details

R0225h 1 Each

Human NPPA / Natriuretic peptides A Recombinant Protein

Sign In for Pricing

View Details

K4740105 3x 1.0 µg

AI848100 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing

View Details

19631053 1.0 mL

FA2H Adenovirus (Human)

Sign In for Pricing

View Details

MP215807 200 Reactions

Slc30a4 Mouse qPCR Primer Pair (NM_011774)

Sign In for Pricing

View Details