Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Thr30]-Neuropeptide Y, human

Product Specifications

Synonyms

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Thr-Ile-Thr-Arg- Gln-Arg-Tyr-NH2; H-YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2

Molecular Formula

C187H280N54O59S

Molecular Weight

4,260.6 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (FN1/2949), CF647 conjugate, 0.1mg/mL
BNC472949-100 1x 100 µL

Fibronectin (FN1/2949), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triethylsilane
TRC-T777400-5G 5 g

Triethylsilane

Sign In for Pricing
View Details
Sterol carrier 2 Antibody
KC-2668-01 50 μL

Sterol carrier 2 Antibody

Sign In for Pricing
View Details
Sterol carrier 2 Antibody
KC-2668-02 100 µL

Sterol carrier 2 Antibody

Sign In for Pricing
View Details
Sterol carrier 2 Antibody
KC-2668-03 1 mL

Sterol carrier 2 Antibody

Sign In for Pricing
View Details
Polystyrene A CHO
HA110006.5G 5 g

Polystyrene A CHO

Sign In for Pricing
View Details