Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Thr30]-Neuropeptide Y, human

Product Specifications

Synonyms

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Thr-Ile-Thr-Arg- Gln-Arg-Tyr-NH2; H-YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2

Molecular Formula

C187H280N54O59S

Molecular Weight

4,260.6 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCYL1BP1 (GORAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]
TA800286AM 100 µL

SCYL1BP1 (GORAB) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D1]

Sign In for Pricing
View Details
IRAK4 (NM_016123) Human Over-expression Lysate
LY402503 100 µg

IRAK4 (NM_016123) Human Over-expression Lysate

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (6F-H2), CF488A conjugate, 0.1mg/mL
BNC880856-500 1x 500 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF Antibody
KC-371-01 50 μL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-371-02 100 µL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-371-03 1 mL

TNF Antibody

Sign In for Pricing
View Details