Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Thr30]-Neuropeptide Y, human

Product Specifications

Synonyms

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Thr-Ile-Thr-Arg- Gln-Arg-Tyr-NH2; H-YPSKPDNPGEDAPAEDMARYYSALRHYINTITRQRY-NH2

Molecular Formula

C187H280N54O59S

Molecular Weight

4,260.6 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF640R conjugate, 0.1mg/mL
BNC402480-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENOX1 (NM_017993) Human Over-expression Lysate
LY402636 100 µg

ENOX1 (NM_017993) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS511034 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Cofilin 1 (CFL1) (N-term) Rabbit Polyclonal Antibody
AP17209PU-N 400 µL

Cofilin 1 (CFL1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p95 NBS1 (NBN) Rabbit Polyclonal Antibody
TA384837 100 µL

p95 NBS1 (NBN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C6orf138 (PTCHD4) (Center) Rabbit Polyclonal Antibody
AP50649PU-N 400 µL

C6orf138 (PTCHD4) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details