Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, porcine

Product Specifications

Synonyms

Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys- Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; H-YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ-OH

Molecular Formula

C225H342N60O66S

Molecular Weight

4,975.66 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF740 conjugate, 0.1mg/mL
BNC741924-100 1x 100 µL

P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]
CL007P 250 µg

Cd8a Rat Monoclonal Antibody [Clone ID: YTS169.4]

Sign In for Pricing
View Details
CNOT7 Antibody
8C11858-AAT 50 µg

CNOT7 Antibody

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (MITF/915), CF405S conjugate, 0.1mg/mL
BNC040915-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (MITF/915), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DLGAP2 Human Gene Knockout Kit (CRISPR)
KN416913 1 Kit

DLGAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ODR4 (C1orf27) (NM_001164245) Human Over-expression Lysate
LC431374 20 µg

ODR4 (C1orf27) (NM_001164245) Human Over-expression Lysate

Sign In for Pricing
View Details