Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP, porcine

Product Specifications

Synonyms

Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys- Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; H-YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ-OH

Molecular Formula

C225H342N60O66S

Molecular Weight

4,975.66 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7240-5p inhibitor
HY-RI04018-01 5 nmol

Mmu-miR-7240-5p inhibitor

Sign In for Pricing
View Details
Mmu-miR-7240-5p inhibitor
HY-RI04018-02 20 nmol

Mmu-miR-7240-5p inhibitor

Sign In for Pricing
View Details
GASP-2 Double Nickase Plasmid (h2)
sc-418296-NIC-2 20 µg

GASP-2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Human ZNF20 Protein, N-His
orb3153798-01 50 µg

Recombinant Human ZNF20 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ZNF20 Protein, N-His
orb3153798-02 100 µg

Recombinant Human ZNF20 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ZNF20 Protein, N-His
orb3153798-03 1 mg

Recombinant Human ZNF20 Protein, N-His

Sign In for Pricing
View Details