What is the catalog number for GIP, porcine?

The catalog number for GIP, porcine is VAC-00851.

What sizes are available for GIP, porcine?

GIP, porcine is available in the following size(s): 1 mg, 5 mg, 10 mg.

How many pack sizes does GIP, porcine come in?

GIP, porcine is available in 3 different pack sizes.

Is GIP, porcine in stock?

GIP, porcine is currently made to order / not held in immediate stock. Contact us for lead time.

GIP, porcine

Product Specifications

Synonyms

Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys- Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; H-YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ-OH

Molecular Formula

C225H342N60O66S

Molecular Weight

4,975.66 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HY307227-01 1 Each

Anti-Human CD55 Antibody (SAA0839), PE

Sign In for Pricing

View Details

HY307227-02 100 Tests

Anti-Human CD55 Antibody (SAA0839), PE

Sign In for Pricing

View Details

CBP4210-01 1 mg

RPL22 Blocking Peptide

Sign In for Pricing

View Details

CBP4210-02 5 mg

RPL22 Blocking Peptide

Sign In for Pricing

View Details

NBP2-89373AF647 0.1 mL

Rabbit Monoclonal PDGF-C Antibody (004) [Alexa Fluor 647]

Sign In for Pricing

View Details

MBS101192-01 48 Well

Rat Diaphanous Homolog 1 ELISA Kit

Sign In for Pricing

View Details