Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intermedin (human)

Product Specifications

Synonyms

Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg- Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2; H-TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2

Molecular Formula

C219H351N69O66S3

Molecular Weight

5,102.84 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC13 Antibody
MBS8587640-01 0.1 mg

MUC13 Antibody

Sign In for Pricing
View Details
MUC13 Antibody
MBS8587640-02 0.1 mL (AF405L)

MUC13 Antibody

Sign In for Pricing
View Details
MUC13 Antibody
MBS8587640-03 0.1 mL (AF405S)

MUC13 Antibody

Sign In for Pricing
View Details
MUC13 Antibody
MBS8587640-04 0.1 mL (AF610)

MUC13 Antibody

Sign In for Pricing
View Details
MUC13 Antibody
MBS8587640-05 0.1 mL (AF635)

MUC13 Antibody

Sign In for Pricing
View Details
MUC13 Antibody
MBS8587640-06 0.1 mL (APC)

MUC13 Antibody

Sign In for Pricing
View Details