Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Preprogalanin 28-67, rat

Product Specifications

Synonyms

Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu- Thr-Gly-Lys-Arg-Glu-Leu-Pro; H-TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP-OH

Molecular Formula

C198H312N62O58

Molecular Weight

4,488.96 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAMD3 Human Gene Knockout Kit (CRISPR)
KN421462 1 Kit

SAMD3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EEA1 Goat Polyclonal Antibody
AB0006-200 600 µg

EEA1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
L-Carnosine
TRC-C184190-25G 25 g

L-Carnosine

Sign In for Pricing
View Details
Dihydrorhodamine 123, dihydrochloride salt, 20x500ug
#10056-1 20x 500 µg

Dihydrorhodamine 123, dihydrochloride salt, 20x500ug

Sign In for Pricing
View Details
SPACA4 (NM_133498) Human Recombinant Protein
TP308285M 100 µg

SPACA4 (NM_133498) Human Recombinant Protein

Sign In for Pricing
View Details
MIOX (NM_017584) Human Recombinant Protein
TP310070L 1 mg

MIOX (NM_017584) Human Recombinant Protein

Sign In for Pricing
View Details