Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Preprogalanin 28-67, rat

Product Specifications

Synonyms

Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu- Thr-Gly-Lys-Arg-Glu-Leu-Pro; H-TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP-OH

Molecular Formula

C198H312N62O58

Molecular Weight

4,488.96 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 3- ((5-chloro-2-methoxyphenyl) amino) -5-methyl-2,4-thiazolecarboxylate
YQB47602 250 mg

Ethyl 3- ((5-chloro-2-methoxyphenyl) amino) -5-methyl-2,4-thiazolecarboxylate

Sign In for Pricing
View Details
RCC1 (NM_001048194) Human Tagged ORF Clone
RC216794 10 µg

RCC1 (NM_001048194) Human Tagged ORF Clone

Sign In for Pricing
View Details
EPHB4 Peptide
AF5271-BP 1 mg

EPHB4 Peptide

Sign In for Pricing
View Details
Grik2-set siRNA/shRNA/RNAi Lentivector (Rat)
22667096 4x 500 ng

Grik2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 Glycoprotein gp2 (US4)
MBS7033262-01 0.02 mg

Recombinant Equine herpesvirus 1 Glycoprotein gp2 (US4)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 1 Glycoprotein gp2 (US4)
MBS7033262-02 0.1 mg

Recombinant Equine herpesvirus 1 Glycoprotein gp2 (US4)

Sign In for Pricing
View Details