Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Preprogalanin 28-67, rat

Product Specifications

Synonyms

Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu- Thr-Gly-Lys-Arg-Glu-Leu-Pro; H-TKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGLTGKRELP-OH

Molecular Formula

C198H312N62O58

Molecular Weight

4,488.96 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pak1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4567406 1.0 µg DNA

Pak1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
MPZL1
CSB-CL014775HU1 10 μg Plasmid + 200 μL Glycerol

MPZL1

Sign In for Pricing
View Details
Mouse Monoclonal dsRNA Antibody (K1) [Alexa Fluor 594]
NBP3-11397AF594 0.2 mL

Mouse Monoclonal dsRNA Antibody (K1) [Alexa Fluor 594]

Sign In for Pricing
View Details
IL1RAP Protein Lysate
OCOA21191-20UG 20 µg

IL1RAP Protein Lysate

Sign In for Pricing
View Details
CCDC49 Polyclonal Antibody, APC-Cy7 Conjugated
bs-17611R-APC-Cy7 100 µL

CCDC49 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
3-​Oxime Estra-​4, ​9, ​11-​triene-​3, ​17-​dione
426554-01 5 mg

3-​Oxime Estra-​4, ​9, ​11-​triene-​3, ​17-​dione

Sign In for Pricing
View Details