Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4 (3-39)

Product Specifications

Synonyms

Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro- Pro-Ser-NH2; H-TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Molecular Formula

C176H271N46O58S1

Molecular Weight

3,991.36 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECT2 (Center) Rabbit Polyclonal Antibody
AP51360PU-N 400 µL

ECT2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDGF Receptor beta (PDGFRB) (NM_002609) Human Over-expression Lysate
LC400921 20 µg

PDGF Receptor beta (PDGFRB) (NM_002609) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Klk1b9 activation kit by CRISPRa
GA201199 1 Kit

Mouse Klk1b9 activation kit by CRISPRa

Sign In for Pricing
View Details
Apol10a Mouse Gene Knockout Kit (CRISPR)
KN501424 1 Kit

Apol10a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adrenocorticotropic Hormone (ACTH) ELISA Kit
K072-H1 1 Plate

Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3228), 0.2mg/mL
BNUB3228-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3228), 0.2mg/mL

Sign In for Pricing
View Details