Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4 (3-39)

Product Specifications

Synonyms

Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro- Pro-Ser-NH2; H-TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Molecular Formula

C176H271N46O58S1

Molecular Weight

3,991.36 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPC2 Polyclonal Antibody
E-AB-52814-01 20 µL

NPC2 Polyclonal Antibody

Sign In for Pricing
View Details
NPC2 Polyclonal Antibody
E-AB-52814-02 60 µL

NPC2 Polyclonal Antibody

Sign In for Pricing
View Details
NPC2 Polyclonal Antibody
E-AB-52814-03 120 µL

NPC2 Polyclonal Antibody

Sign In for Pricing
View Details
NPC2 Polyclonal Antibody
E-AB-52814-04 200 µL

NPC2 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS706519 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
4-Chlorobenzoic anhydride
TRC-C427630-500MG 500 mg

4-Chlorobenzoic anhydride

Sign In for Pricing
View Details