Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4 (3-39)

Product Specifications

Synonyms

Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro- Pro-Ser-NH2; H-TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Molecular Formula

C176H271N46O58S1

Molecular Weight

3,991.36 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DICER1, C-His Tag
HA210673-01 20 µg

Human DICER1, C-His Tag

Sign In for Pricing
View Details
Human DICER1, C-His Tag
HA210673-02 50 µg

Human DICER1, C-His Tag

Sign In for Pricing
View Details
Human DICER1, C-His Tag
HA210673-03 100 µg

Human DICER1, C-His Tag

Sign In for Pricing
View Details
SIX2 Rabbit Polyclonal Antibody
ER2001-39 100 µL

SIX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Catalase Rabbit Polyclonal Antibody
ER40125 100 µL

Catalase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human INTS10 activation kit by CRISPRa
GA110575 1 Kit

Human INTS10 activation kit by CRISPRa

Sign In for Pricing
View Details