Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-45 , rat

Product Specifications

Synonyms

Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala- Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe; H-SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF-OH

Molecular Formula

C213H349N71O65S3

Molecular Weight

5,040.79 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Novel Coronavirus Nucleoprotein (N) (P13L, Δ31-33, R203K, G204R)
CSB-YP3325GMY(M18)-01 20 µg

Recombinant Human Novel Coronavirus Nucleoprotein (N) (P13L, Δ31-33, R203K, G204R)

Sign In for Pricing
View Details
Recombinant Human Novel Coronavirus Nucleoprotein (N) (P13L, Δ31-33, R203K, G204R)
CSB-YP3325GMY(M18)-02 100 µg

Recombinant Human Novel Coronavirus Nucleoprotein (N) (P13L, Δ31-33, R203K, G204R)

Sign In for Pricing
View Details
Recombinant Human Novel Coronavirus Nucleoprotein (N) (P13L, Δ31-33, R203K, G204R)
CSB-YP3325GMY(M18)-03 1 mg

Recombinant Human Novel Coronavirus Nucleoprotein (N) (P13L, Δ31-33, R203K, G204R)

Sign In for Pricing
View Details
2410042D21Rik ORF Vector (Mouse) (pORF)
10434014 1.0 µg DNA

2410042D21Rik ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SF3B4 (Splicing Factor 3B Subunit 4, Pre-mRNA-splicing Factor SF3b 49kD Subunit, SF3b50, Spliceosome-associated Protein 49, SAP 49, SAP49, MGC10828) discontinued
150940 100 µg

SF3B4 (Splicing Factor 3B Subunit 4, Pre-mRNA-splicing Factor SF3b 49kD Subunit, SF3b50, Spliceosome-associated Protein 49, SAP 49, SAP49, MGC10828) discontinued

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, γ-Seminoprotein, P-30 antigen) (MaxLight 650) discontinued
P9054-50-ML650 100 µL

Prostate Specific Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, γ-Seminoprotein, P-30 antigen) (MaxLight 650) discontinued

Sign In for Pricing
View Details