Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-45 , rat

Product Specifications

Synonyms

Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala- Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe; H-SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF-OH

Molecular Formula

C213H349N71O65S3

Molecular Weight

5,040.79 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRSAM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
27726066 1.0 µg DNA

LRSAM1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Gm5941 Protein Lysate (Mouse) with C-HA Tag
22145034 100 µg

Gm5941 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CABC1 CRISPR Activation Plasmid (h2)
sc-408674-ACT-2 20 µg

CABC1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Mouse Olfr1048 (NM_147014) AAV Particle
MR213988A1V 250 µL

Mouse Olfr1048 (NM_147014) AAV Particle

Sign In for Pricing
View Details
CDK4 antibody
CAF50069 100 µg

CDK4 antibody

Sign In for Pricing
View Details
Anti-ETNK1 Antibody Picoband® Biotin Conjugated
A10379-Biotin 100 µg/Vial

Anti-ETNK1 Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details