Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNP-45 , rat

Product Specifications

Synonyms

Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala- Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe; H-SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF-OH

Molecular Formula

C213H349N71O65S3

Molecular Weight

5,040.79 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin Alpha V Rabbit Polyclonal Antibody
orb10927-01 50 μL

Integrin Alpha V Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Integrin Alpha V Rabbit Polyclonal Antibody
orb10927-02 100 µL

Integrin Alpha V Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Integrin Alpha V Rabbit Polyclonal Antibody
orb10927-03 200 µL

Integrin Alpha V Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Mitochondria Antibody (MTC02/2860R) [DyLight 594]
NBP3-08548DL594 100 µL

Rabbit Monoclonal Mitochondria Antibody (MTC02/2860R) [DyLight 594]

Sign In for Pricing
View Details
TACI Protein, Human, Recombinant (ECD, His Tag)
PH50691M2-01 100 µg

TACI Protein, Human, Recombinant (ECD, His Tag)

Sign In for Pricing
View Details
TACI Protein, Human, Recombinant (ECD, His Tag)
PH50691M2-02 1 mg

TACI Protein, Human, Recombinant (ECD, His Tag)

Sign In for Pricing
View Details