Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37, reverse sequence

Product Specifications

Synonyms

Ser-Glu-Thr-Arg-Pro-Val-Leu-Asn-Arg-Leu-Phe-Asp-Lys-Ile-Arg-Gln-Val-Ile-Arg-Lys-Phe-Glu-Lys-Gly-Ile-Lys-Glu-Lys-Ser-Lys-Arg-Phe-Phe- Asp-Gly-Leu-Leu; H-SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL-OH

Molecular Formula

C205H340N60O53

Molecular Weight

4,493.37 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WSCD1 Knockout HEK293T cell line
GTR15407801 1 Vial

Human WSCD1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Haematoxylin Gill (Formula I)
RRSP64-F 2.5 L

Haematoxylin Gill (Formula I)

Sign In for Pricing
View Details
MCA3 Rabbit Polyclonal Antibody
BT-AP11252-01 20 µL

MCA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCA3 Rabbit Polyclonal Antibody
BT-AP11252-02 50 µL

MCA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCA3 Rabbit Polyclonal Antibody
BT-AP11252-03 100 µL

MCA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Grp75/HSPA9 Rabbit Polyclonal Antibody (Fluoro647)
orb3076431 100 µg

Grp75/HSPA9 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details