Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37, reverse sequence

Product Specifications

Synonyms

Ser-Glu-Thr-Arg-Pro-Val-Leu-Asn-Arg-Leu-Phe-Asp-Lys-Ile-Arg-Gln-Val-Ile-Arg-Lys-Phe-Glu-Lys-Gly-Ile-Lys-Glu-Lys-Ser-Lys-Arg-Phe-Phe- Asp-Gly-Leu-Leu; H-SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL-OH

Molecular Formula

C205H340N60O53

Molecular Weight

4,493.37 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TSH R Antibody (TSHRB/1404) [Alexa Fluor 647]
NBP2-54395AF647 100 µL

Mouse Monoclonal TSH R Antibody (TSHRB/1404) [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) (Y134P)
orb3003925-01 20 µg

Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) (Y134P)

Sign In for Pricing
View Details
Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) (Y134P)
orb3003925-02 100 µg

Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) (Y134P)

Sign In for Pricing
View Details
Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) (Y134P)
orb3003925-03 1 mg

Recombinant Human Glycogen synthase kinase-3 beta (GSK3B) (Y134P)

Sign In for Pricing
View Details
C3a-receptor discontinued
590011 200 µg

C3a-receptor discontinued

Sign In for Pricing
View Details
MRT4 sgRNA CRISPR Lentivector (Human) (Target 2)
K1339803 1.0 µg DNA

MRT4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details