Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL-37, reverse sequence

Product Specifications

Synonyms

Ser-Glu-Thr-Arg-Pro-Val-Leu-Asn-Arg-Leu-Phe-Asp-Lys-Ile-Arg-Gln-Val-Ile-Arg-Lys-Phe-Glu-Lys-Gly-Ile-Lys-Glu-Lys-Ser-Lys-Arg-Phe-Phe- Asp-Gly-Leu-Leu; H-SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL-OH

Molecular Formula

C205H340N60O53

Molecular Weight

4,493.37 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKNOX2 Peptide - middle region (AAP39536)
AAP39536-100UG 100 µg

PKNOX2 Peptide - middle region (AAP39536)

Sign In for Pricing
View Details
CCR3 (NM_178328) Human Tagged Lenti ORF Clone
RC228305L4 10 µg

CCR3 (NM_178328) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Monoclonal RelB Antibody (9E4)
NBP3-26348-100ul 100 µL

Rabbit Monoclonal RelB Antibody (9E4)

Sign In for Pricing
View Details
STFR P031-600x200-PE-CRD/1 AC Signs
826037 Card of 1 Pictogram(s)

STFR P031-600x200-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
Pituitary homeobox 2
AP78946-01 50 µg

Pituitary homeobox 2

Sign In for Pricing
View Details
Pituitary homeobox 2
AP78946-02 100 µg

Pituitary homeobox 2

Sign In for Pricing
View Details