Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-gp41-Antigenic Peptide 5

Product Specifications

Synonyms

Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala-Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys-His-Thr-Thr-Val-Pro-Trp-Val- Asn-Asp-Ser-NH2; H-RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2

Molecular Formula

C184H282N56O53S2

Molecular Weight

4,190.77 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 1 Receptor Antagonist (IL-1ra) Porcine ELISA Kit
E3574 96 Tests

Interleukin 1 Receptor Antagonist (IL-1ra) Porcine ELISA Kit

Sign In for Pricing
View Details
Recombinant Toxoplasma Gondii MT-CYB Protein (aa 1-368)
VAng-0442Lsx-1mgYeast 1 mg (Yeast)

Recombinant Toxoplasma Gondii MT-CYB Protein (aa 1-368)

Sign In for Pricing
View Details
Arid5b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3783802 1.0 µg DNA

Arid5b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Bhmt 3'UTR GFP Stable Cell Line
TU251325 1.0 mL

Bhmt 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human GDF15 ELISA Kit
EHG0134 96 Tests

Human GDF15 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-SARS-CoV-02 3CLpro pAb
PA12636-01 50 μL

Rabbit Anti-SARS-CoV-02 3CLpro pAb

Sign In for Pricing
View Details