Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-gp41-Antigenic Peptide 5

Product Specifications

Synonyms

Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala-Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys-His-Thr-Thr-Val-Pro-Trp-Val- Asn-Asp-Ser-NH2; H-RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2

Molecular Formula

C184H282N56O53S2

Molecular Weight

4,190.77 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABL2A Rabbit Polyclonal Antibody (FITC)
orb2109423 100 µL

RABL2A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
FH Rabbit mAb
orb1564909-01 20 ul

FH Rabbit mAb

Sign In for Pricing
View Details
FH Rabbit mAb
orb1564909-02 50 µL

FH Rabbit mAb

Sign In for Pricing
View Details
FH Rabbit mAb
orb1564909-03 100 µL

FH Rabbit mAb

Sign In for Pricing
View Details
FOXP1 Antibody, FITC conjugated
A22283-50UG 50 µg

FOXP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Compound NP-024120
MBS5793125 Inquire

Compound NP-024120

Sign In for Pricing
View Details