Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-gp41-Antigenic Peptide 5

Product Specifications

Synonyms

Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala-Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys-His-Thr-Thr-Val-Pro-Trp-Val- Asn-Asp-Ser-NH2; H-RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2

Molecular Formula

C184H282N56O53S2

Molecular Weight

4,190.77 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal C8orf42 Antibody - N-terminal region
APR01756G 0.05mg

Polyclonal C8orf42 Antibody - N-terminal region

Sign In for Pricing
View Details
PI 3 Kinase p110 delta recombinant monoclonal antibody
A5218 100ul X 3

PI 3 Kinase p110 delta recombinant monoclonal antibody

Sign In for Pricing
View Details
PCK1 Recombinant Antibody, PE-Cy7 Conjugated
bsm-61722R-PE-Cy7-TR 20 µL

PCK1 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ZDHHC20P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV756325 1.0 µg DNA

ZDHHC20P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
CDK1 Antibody
MBS7122672-01 0.05 mg

CDK1 Antibody

Sign In for Pricing
View Details
CDK1 Antibody
MBS7122672-02 0.1 mg

CDK1 Antibody

Sign In for Pricing
View Details