Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIV-gp41-Antigenic Peptide 5

Product Specifications

Synonyms

Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala-Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys-His-Thr-Thr-Val-Pro-Trp-Val- Asn-Asp-Ser-NH2; H-RVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDS-NH2

Molecular Formula

C184H282N56O53S2

Molecular Weight

4,190.77 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANPEP CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
12060154 3x 1.0 µg DNA

ANPEP CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
LRRC19, CT (LRRC19, Leucine-rich repeat-containing protein 19) (MaxLight 550)
MBS6317017-01 0.1 mL

LRRC19, CT (LRRC19, Leucine-rich repeat-containing protein 19) (MaxLight 550)

Sign In for Pricing
View Details
LRRC19, CT (LRRC19, Leucine-rich repeat-containing protein 19) (MaxLight 550)
MBS6317017-02 5x 0.1 mL

LRRC19, CT (LRRC19, Leucine-rich repeat-containing protein 19) (MaxLight 550)

Sign In for Pricing
View Details
Snca siRNA Oligos set (Rat)
44541176 3x 5 nmol

Snca siRNA Oligos set (Rat)

Sign In for Pricing
View Details
CACNB1 (NM_199247) Human Over-expression Lysate
LH16918V 100 µg

CACNB1 (NM_199247) Human Over-expression Lysate

Sign In for Pricing
View Details
F2RL1 Antibody
OALA00474-50UG 50 µg

F2RL1 Antibody

Sign In for Pricing
View Details