Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intermedin (rat)

Product Specifications

Synonyms

Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg- Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2; H-PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2

Molecular Formula

C226H361N75O64S2

Molecular Weight

5,216.99 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb914445 100 µL

PAR1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
5HT2C Receptor Rabbit Polyclonal Antibody (PE-Cy7)
orb888111 100 µL

5HT2C Receptor Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Cathepsin W (CTSW, Lymphopain) (MaxLight 650)
MBS6221264-01 0.1 mL

Cathepsin W (CTSW, Lymphopain) (MaxLight 650)

Sign In for Pricing
View Details
Cathepsin W (CTSW, Lymphopain) (MaxLight 650)
MBS6221264-02 5x 0.1 mL

Cathepsin W (CTSW, Lymphopain) (MaxLight 650)

Sign In for Pricing
View Details
PATZ1 Rabbit Polyclonal Antibody (Fluoro647)
orb3101218 100 µg

PATZ1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Naptumomab (Anti-TPBG)
C00679-01 1 mg

Naptumomab (Anti-TPBG)

Sign In for Pricing
View Details