Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Intermedin (rat)

Product Specifications

Synonyms

Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg- Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2; H-PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2

Molecular Formula

C226H361N75O64S2

Molecular Weight

5,216.99 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyk2, phosphorylated (Tyr402) (CAKbeta, cdk-activating Protein Kinase beta)
P9400-25 10 Blots

Pyk2, phosphorylated (Tyr402) (CAKbeta, cdk-activating Protein Kinase beta)

Sign In for Pricing
View Details
Mmp14 3'UTR Luciferase Stable Cell Line
TU113273 1.0 mL

Mmp14 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Fmoc-His (1-Me) -OH
4028992.0250 250 mg

Fmoc-His (1-Me) -OH

Sign In for Pricing
View Details
PLV3-CMV-BHLHE41-3xFLAG-CopGFP-Puro Plasmid
PVT84793 2 µg

PLV3-CMV-BHLHE41-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
CDKN2A Knockout Hela Polyclonal Cells
ARG8324 1 Million

CDKN2A Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
LentimiRa-mmu-miR-6918-3p Vector
mm41560 500 ng

LentimiRa-mmu-miR-6918-3p Vector

Sign In for Pricing
View Details