Intermedin (rat)
Product Specifications
Synonyms
Pro-His-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Val-Arg-Pro-Ser-Gly-Arg- Arg-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH2; H-PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2
Molecular Formula
C226H361N75O64S2
Molecular Weight
5,216.99 g/mol
Controlled
No
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2112315-01 0.1 mL
Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 3 (PTPN3)
Sign In for Pricing
View Details MBS2112315-02 0.2 mL
Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 3 (PTPN3)
Sign In for Pricing
View Details MBS2112315-03 0.5 mL
Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 3 (PTPN3)
Sign In for Pricing
View Details MBS2112315-04 1 mL
Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 3 (PTPN3)
Sign In for Pricing
View Details MBS2112315-05 5 mL
Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 3 (PTPN3)
Sign In for Pricing
View Details MBS2112315-06 5x 5 mL
Polyclonal Antibody to Protein Tyrosine Phosphatase, Non Receptor Type 3 (PTPN3)
Sign In for Pricing
View Details