Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lytic Peptide, SB – 37

Product Specifications

Synonyms

Met-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu- Ala-Lys-Ala-Leu-Gly; H-MPKWKVFKKIEKVGRNIRNGIVKAGPAIAVLGEAKALG-OH

Molecular Formula

C188H320N54O45S

Molecular Weight

4,088.94 g/mol

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid Hormone (1-84) Human Recombinant (PTH (1-84) Human)
PT_41898-01 100 µg

Parathyroid Hormone (1-84) Human Recombinant (PTH (1-84) Human)

Sign In for Pricing
View Details
Parathyroid Hormone (1-84) Human Recombinant (PTH (1-84) Human)
PT_41898-02 500 µg

Parathyroid Hormone (1-84) Human Recombinant (PTH (1-84) Human)

Sign In for Pricing
View Details
Parathyroid Hormone (1-84) Human Recombinant (PTH (1-84) Human)
PT_41898-03 1 mg

Parathyroid Hormone (1-84) Human Recombinant (PTH (1-84) Human)

Sign In for Pricing
View Details
Recombinant Human NARS Protein, His, Insect-2ug
QP12794-HIS-INSECT-2ug 2ug

Recombinant Human NARS Protein, His, Insect-2ug

Sign In for Pricing
View Details
Lentiviral mouse Pcsk5 shRNA (UAS) - Lentiviral mouse Pcsk5 shRNA (UAS, iRFP) (100)
GTR15259227 1 Vial

Lentiviral mouse Pcsk5 shRNA (UAS) - Lentiviral mouse Pcsk5 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Hsf3 Protein Lysate (Mouse) with C-HA Tag
23963034 100 µg

Hsf3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details